Open access peer-reviewed chapter

Environment-Induced Silk Fibroin Conformation Based on the Magnetic Resonance Spectroscopy

By Teng Jiang and Ping Zhou

Submitted: October 27th 2010Reviewed: March 24th 2011Published: August 29th 2011

DOI: 10.5772/18479

Downloaded: 2304

1. Introduction

Recently, silk fibroin has been widely attended for its biomedical material applications, because of its excellent properties such as strength, flexibility, biocompatibility and permeability (Altman et al., 2003). Compared with the silk fibroin from silkworm, spider fibroin has higher strength and stronger toughness, but its resource is limited. So people have tried to synthesize the spider fibroin using genetic recombination method to obtain the spider fibers (Fukushima, 1998; Heslot, 1998; Zhou et al., 2001). Shao et al. (Shao & Vollrath, 2002) demonstrated that although the amino acid sequence of Bombyx mori silkworm fibroin is different from that of spider fibroin, by controlling the process of the silkworm spinning, the high strength of the silk fiber as that of the spider fiber can be gained. The investigations indicate that there are the correlations among spinning process, secondary structure and mechanical properties of the silk fibroin. The environment of the silkworm spinning is changed during the process, such as shearing strength (Chen et al., 2001; Shao & Vollrath, 2002; Terry et al., 2004), pH (Magoshi et al., 1996; Xie et al., 2004; Zhou et al., 2004; Zong et al., 2004), concentration of metal ions (Li et al., 2001; Ruan et al., 2008; Zhou et al., 2004; Zong et al., 2004) and concentration of the silk fibroins (Magoshi et al., 1996; Terry et al., 2004), etc. Therefore, studying the environment effects on the silk fibroin conformation is benefit to understand the silkworm spinning mechanism, and helpful to synthesize artificially the silk fibroin or spidroin and fabricate the high performance silk fiber to meet the requirements of the biomaterial usages.

The methods used to investigate the silk fibroin mainly include X-ray diffraction (XRD) (Lv et al., 2005; March et al., 1955; Qiao et al., 2009; Takahashi et al., 1999; Saitoh et al., 2004; Sinsawat et al., 2002), electron diffraction (ED) (He et al., 1999), infrared (IR) (Chen et al., 2001; Mo et al., 2006), nuclear magnetic resonance (NMR) (Yao et al., 2004; Zhao et al., 2001) and so on. Among them, nuclear magnetic resonance spectroscopy is very effective to characterize the molecular chain structures of the biopolymers (Du et al., 2003; Li et al., 2008). Asakura et al. analyzed the crystal structures of 40 proteins and their NMR chemical shifts, and established the correlation of Ala, Ser, and Gly residues between 13C chemical shifts of Cα, Cβ atoms and the dihedral angels of and of the peptide chains, which are very useful to determine the protein structure by NMR method (Asakura et al., 1999). The authors also carried out a series of solid-state 13C NMR experiments to study the peptides (AG)n, a model compound of the silk fibroin, using spin diffusion NMR and rotational echo double resonance (REDOR) techniques (Asakura, 2001, 2002 a, 2002b, 2002c, 2005a, 2005c, 2007). They found two types of the secondary structures of β-turn and β-sheet. The authors suggested that the peptides GAAS in the heavy chain of silk fibroin are one of the factors influencing the structural transition of the silk fibroin from random coil to β-sheet (Asakura et al., 2002) in which the –OH ligands of Ser residues participate in the formation of hydrogen bonds (Askura, 2002, 2005; Sato et al., 2008), and Tyr, replacing the Ser in the basic (AGSGAG)n sequence, can induce the partially disordered structure (Asakura et al., 2005). Ha et al. synthesized the non-crystalline silk peptide which contains 31 amino acid residues (GTGSSGFGPYVANGGYSGYEYAWSSESDFGT), and used high resolution 2D-NMR techniques, such as COSY, TOCSY, NOESY, ROESY and HMQC and HMBC, to study the structure of the peptide in solution. They proved that the structure of the peptide is a loop (Ha et al., 2005).

Our group has investigated the environmental influences on the conformation of silk fibroin by solid-state 13C NMR during the past few years. Moreover, we also used EPR method to study the interaction between the metal ions of Cu2+, Fe3+, Mn2+ and silk fibroin, and tried to understand the role of the metal ions in the conformation transition. We are going to review our research results in this paper.

2. Component of silk fibroin and spinning process of the Bombyx mori silkworm

The heavy-chain fibroin is predominant component (up to 85% w/w) in Bombyx mori silk fibroin in addition to the light-chain fibroin including sericin and P25 (Couble et al., 1985; Tanaka et al., 1999). Bombyx mori silk fibroin (B. mori SF) has 5263 amino acid residues composed of 45.9% glycine (Gly), 30.3% alanine (Ala), 12.1% serine (Ser), 5.3% tyrosine (Tyr), 1.8% valine (Val), 0.25% tryptophan (Trp), 0.1% histidine (His) residues, etc. and has a molecular weight of 391 kDa (ExPASY, P05790, E.P.A.S.; P07856). Four types of repetitive sequence are mainly found in the heavy-chain silk fibroin, i.e. GAGAGS, GAGAGY and GAGAGVGY, forming hydrophobic domains, and eleven repetitive sequences GTGSSGFGPYVA(N/H)GGYSGYEYAWSSESDFGT forming fairly conserved hydrophilic spacers (Zhou et al., 2000). The silk fibroin exhibits excellent mechanical properties due to the primary structure of highly repetitive amino acid sequences (GAGAGX)n, X = Ala, Ser, Tyr (Y), Val, etc., in which the repetitive hexapeptides (GAGAGS)n tend to be in the crystalline form, while (GAGAGY)n to be in the amorphous form to link the hydrophobic and hydrophilic domains along the protein chain (Mita et al., 1994; Shen et al., 1998).

During the natural silk spinning from the spinneret of a silkworm, the conformation of the silk fibroin is converted from a soluble helical form to an insoluble β-sheet form (Magoshi et al., 1996). Magoshi et al. (Kobayashi et al., 2001; Magoshi et al., 1996) found that pH changes gradually in the lumen of the silkworm from neutral (pH 6.9) in the posterior division to weakly acidic (pH 4.8) in the anterior division adjacent to the spinneret. Meantime, the concentration of the inorganic ions such as Ca2+, K+ and Mg2+ vary within each division of the silk gland (Hossain et al., 2003; Magoshi et al., 1996), which promotes the transition from gel to sol state and then formation of the silk fiber (Kobayashi et al., 2001).

Figure 1.

Schematic illustration of the natural silk fibroin spinning process. (a) nucleation, which includes a transition of random coil to β-strand as well as a formation of the ordered β-sheet aggregates (nuclei); (b) aggregation growth, which involves the coiled chain changing its conformation on the preformed β-sheet nuclei, followed by formation of the larger β-sheet aggregation (From Li et al., 2001 with permission).

Li et al. (Li et al., 2001) used circular dichroism (CD) spectroscopy to study the conformation transition of the silk fibroin from random coil to β-sheet and the β-sheet aggregation growth. The authors suggested a nucleation-dependent aggregation mechanism for the silk spinning process as in Fig. 1. There are two steps involved in this mechanism: (a) nucleation, a rate-limited step involving the conversion of the soluble random coil to insoluble β-sheet and subsequently a series of thermodynamically unfavorable association of the β-sheet unit, i.e. the formation of a nucleus or seed; (b) once the nucleus forms, further growth of the β-sheet unit becomes thermodynamically favorable, resulting in a rapid extension of the β-sheet aggregation. The aggregation growth follows a first order kinetic process with respect to the fibroin concentration. The increase of the temperature accelerates the β-sheet aggregation growth if the β-sheet nucleus is introduced into the random coil fibroin solution. Meanwhile, the increase of the concentration of the metal ions, Ca2+, K+, Cu2+, Zn2+ and Fe3+, can also accelerate this change in some extent (Li et al., 2001; Ruan et al., 2008; L. Zhou et al, 2003; P. Zhou et al., 2004; Zong et al., 2004; Ji et al., 2009).

Moreover, the shearing strength plays a key role in the formation of fiber, and the cooperation with pH and metal ions is necessary in the spinning process. The natural evolution of the silkworm develops the special spinning process, leading to the excellent performance of the silk fiber. Therefore, understanding the silkworm spinning process is helpful for ones to manufacture the high performance artificial fibers.

3. Secondary structure of silk fibroin

There are mainly two typical conformations, Silk I and Silk II, in the crystalline/semi-crystalline domains of the heavy-chain silk fibroin. Kratky et al. (Kratky et al., 1950) found an unstable crystal domain approaching the spinneret, named “Silk I” which is dominated by the helix conformation, as well as another stable crystal domain in the spun fibers, named “Silk II” which is dominated by the β-sheet conformation. Valuzzi et al. (Valluzzi, 1996, 1997, 1999) found a 32-helical structure of Bombyx mori silk in ultrathin films formed at the air-water interface, named “silk III”, indicating that the structure might be a transitional state from Silk I to Silk II. That means, in the spinning process, the Silk I conformation is transited to the Silk III conformation, and then to the Silk II conformation. There are many NMR researches about Silk I and Silk II (Asakura, 1982, 1983, 1984; Kricheldorf et al., 1983; Saito, 1983, 1984; Zhou et al., 2001). The chemical shifts of the main amino acid residues, Gly and Ala, in B. mori silk fiber, degummed silk fiber and solid/liquid regenerated silk fibroin are listed in Table 1. The results show that different secondary structures have the different chemical shifts.

CocoonSilk II49.720.2171.743.9169.4Saito et al., 1983
Degummed silkSilk II48.620.2172.243.1169.6Zhou et al., 2001
R. fibroina (solid)Silk II
Silk I
Zhou et al., 2001
R. fibroin (liquid)Silk I50.016.6175.542.7171.5Asakura et al., 1984

Table 1.

13C chemical shifts of B. mori silk and its regenerated fibroin (From Li et al., 2001 with permission). a regenerated fibroin.

Despite that the B. mori silk fibroin structures were extensively investigated by many experimental methods, e.g., X-ray diffractions, molecular modelling calculations as well as solid-state 13C NMR spectroscopy, a set of definitive structural parameters for both Silk I and Silk II forms are still unclear yet. We used a density functional theory (DFT) approach to assess those available structural parameters based on the comparison of calculated 13C chemical shifts with experimental ones (Zhou et al., 2001). The results indicate that: (i) Silk I form (at 17.0 ± 0.5 ppm) is a 31-helixlike conformation with torsion angles of <> = -59 2, <> = 119 2, <> = 178 2 for alanine residue and <> = -78 2, <> = 149 2, <> = 178 2 for glycine residue in the silk fibroin; (ii) Silk II form (at 20.0 ± 0.5 ppm) individually determined by Marsh (Marsh et al., 1955), Fossey (Fossy et al., 1991) and Asakura (Asakura et al, 1985) are considered to be more rational than those determined by other authors. The resultant torsion angle are <> = -143 6, <> = 142 5 and <> = 178 2 for both Ala and Gly residues. Besides, there are also transitional states: Silk I-like (at 15.0 ± 0.5 ppm) and Silk II-like (at 21.5 ± 0.5 ppm). Asakura studied the peptides (AG)n and indicated that the torsion angles of β-turn in Ala and Gly are (-62º, 125º) and (77º, 10º) (Asakura et al., 2005).

4. Environment influences on the transition of secondary structure of silk fibroin

The spinning process of the silkworm undergoes at normal temperature, normal pressure and aqueous solution with given shearing force, pH value, metallic ion contents and protein concentration.

Asakura et al. (Asakura et al., 1984) proved that the regenerated silk fibroin has the same amino acid sequence and secondary structure as the silk fibroin present in the silk gland. Therefore, we studied the solid regenerated silk fibroin which is prepared by dissolving the silk fiber in 9.3 M KBr solution and dialyzing and then drying in air in order to mimic the spinning process of water lost. The detail preparing process of the regenerated silk fibroin follows the reference report (Li et al., 2001).

4.1. Influence of pH

We used 13C CP/MAS NMR spectroscopy to study the conformation of the silk fibroin within pH range of 5.2 - 8.0 (Xie et al., 2004). Fig. 2(A) shows 13C CP/MAS NMR spectrum of the silk fibroin. The resonance peak at 5 ~ 25 ppm in Fig. 2(B) for the Cβ of Ala residue can distinguish the helix form from the β-sheet form (Liivak et al., 1998). The lineshape of the peak can be deconvoluted into four components, Silk I at 17.0 ± 0.5 ppm and Silk II at 20.0 ±0.5 ppm, as well as transition state components, Silk I-like at 15.0 ± 0.5 ppm and Silk II-like at 21.5 ± 0.5 ppm (Zhou, 2004, 2001; Zong et al., 2004).

Figure 2.

A) 13C CP/MAS NMR spectrum of the regenerated silk fibroin. (B) Deconvolution result of the peak from 5 ~ 25 ppm resulting from the Cβ of alanine. (a) Silk I (b) Silk II (c) Silk II-like (d) Silk I-like. The hollow squares are simulated spectra.

Figure 3.

The effect of pH values on total Silk II contents of silk fibroin.

We define the content of total Silk II conformation as the sum of Silk II and Silk II-like conformers, which is the conformation related to the -sheet form. The dependence of total Silk II content on the pH change is shown in Fig. 3. It is found that as pH decreases, total Silk II content increases. It implies that a decrease in pH favors the conformation transition from Silk I to Silk II. The reduction in negative charge by the protonation of the amino acids may promote a refolding to a more ordered state stabilized by the hydrogen bonding between chains and accompanied by an exclusion of water. The resulting orientation of the molecules and the reduction of the intermolecular distance could promote the formation of the Silk II conformation. Such a mechanism could account for the nucleation dependency of the aggregation and secondary structural transformation of the fibroin observed in vitro and postulated to occur in vivo.

4.2. Influence of Ca2+ and Cu2+

Figure 4 demonstrates that the conformation conversion of the regenerated silk fibroin is dependent on the Ca2+ concentration (Zhou et al., 2004). The low pH (5.2) and the certain amount of Ca2+ ions (10 mg/g) favor the formation of Silk II and Silk II-related intermediate.

Figure 4.

Dependence of total Silk II conformations in silk fibroin at different [Ca2+] and pH values. a, b, c represent the pH 5.2, 6.9, and 8.0, respectively (From Zhou et al., 2004 with permission).

Figure 5.

A) Dependence of total Silk II content at different added [Cu2+] and pH values. a, b, c correspond to pH 5.2, 6.9, and 8.0, respectively; (B) EPR spectra of the Cu(II)/SF complexes at different pH values with added Cu(II) concentration of 1.80 mg/g (From Zong et al., 2004 with permission).

These results, although still lacking structural analysis in detail, may help to account for the role of pH and Ca2+ ions in the natural spinning process of the silkworms.

In addition, the high concentrations of Ca2+ ions partially inhibit the formation of Silk II-related conformation probably by introducing strong electrostatic interaction between molecular chains. It implies that, the relatively higher Ca2+ ion concentrations in the posterior division and the middle part of the middle division than that in the anterior part of the middle division in the silkworm gland (Terry et al., 2004) may prevent the premature β-sheet formation. The re-reduction of the Ca2+ ion content in the anterior division of the gland could be necessary to promote the gel to the sol transition for reducing the gel strength in native fibroin solutions and to permit it to flow through the spinning duct in the latter part of the secretory pathway (Hossain et al., 2003; Magoshi et al., 1994; Ochi et al., 2002).

In addition, we studied the Cu(II) ion influence on the silk fibroin conformation (Zong et al., 2004). From Fig. 5(A), we find that a small amount of Cu(II) addition leads to an increase in the content of total Silk II conformation and the content is highest when Cu(II) concentration is 0.36 mg/g at pH of 5.2, i.e., the molar ratio of Cu to His residues in silk heavy chain is 0.76 : 1. Also, the content of total Silk II is highest when Cu(II) concentration is 0.63 mg/g at pH of 6.9 and 8.0, i.e., the molar ratio of Cu to His residues is 1.33 : 1. However, further addition of Cu(II) (≧0.63 mg/g) results in a gradual reduction in the total Silk II conformation content, but there is still more total Silk II present in the silk fibroin samples with added Cu(II) than that in the samples without added Cu(II) (Fig. 5A).

Fig. 5(B) shows the EPR spectra of the Cu(II)/SF complex membranes prepared with the added Cu(II) concentration of 1.8 mg/g at pH 4.0, 5.2, 6.9, and 8.0, respectively. It is evident that the spectra are remarkably sensitive to pH variation. Table 2 summarizes the extracted parameters from the deconvoluted EPR traces, such as g//, g, A//, and A, and the deconvoluted components for the Cu(II)/SF complexes prepared with the added Cu(II) concentration of 1.8 mg/g at different pH values.

pHComponentA//aA(ag//bg(bg///A//Relevant contents (%)cCoordination modes

Table 2.

Summary of EPR parameters and coordination modes for the Cu(II)/SF complexes prepared at different pH values with the added Cu(II) concentration of 1.8 mg/g (From Zong et al., 2004 with permission). a A (cm-1) = 0.46686 10-4 g A (Gauss), and the absolute error in all reported A values is less than ± 2 G. b Absolute error in g-values ± 0.002. c Relevant error in all reported contents is less than 2%.

The simulated results of the EPR spectra of the Cu(II)/SF complexes at pH 8.0 and 6.9 indicate that the Cu(II) coordination with silk fibroin forms predominantly a square-planar complex with coordination modes of Cu-4N (one Cu atom coordinates four nitrogen atoms) at pH of 8.0 and Cu-3N1O (one Cu atom coordinates three nitrogen atoms and one oxygen atom) at pH of 6.9. As we know, the number of deprotonated nitrogen atoms will increase at higher pH, resulting in more possibilities for Cu(II) coordination to the nitrogen atoms.

Figure 6.

Models for the Cu(II)/SF complex at neutral (A) and weakly acidic conditions (B) (From Zong et al., 2004 with permission).

In the amorphous domain of B. mori silk fibroin chain, which links two crystalline domains, there exist three conserved AHGGYSGY peptides in a silk fibroin heavy chain (Zhou et al., 2000), similar to the peptide sequence of PHGGGWGY in PrP (Donne et al., 1997; Riek et al., 1997). The pH-dependent Cu(II) EPR and coordination modes in the Cu(II)/PrP (Aronoff-Spencer et al., 2000; Miura et al., 1999) and Cu(II)/Aβ (Miura et al., 2000) complexes are strikingly similar to that of the Cu(II)/SF complexes observed here. Therefore, we suggest that the coordination modes and binding sites of Cu(II) with the silk fibroin are similar to those in PrP protein. At neutral pH, Cu(II) coordinates with silk fibroin as a mode of Cu-3N1O. The peptides AHGGYSGY in the silk fibroin may form a complex with Cu(II) by coordination via the imidazole Nπ atom of the His side chain together with two deprotonated main-chain amide nitrogens in the two glycine residues and one hydroxyl in the serine residue (Fig. 6(A)). Under weakly acidic conditions (pH 5.2 - 4.0), the Cu(II) coordination mode may change to Cu-2N2O (one Cu atom coordinates two nitrogen atoms and two oxygen atoms), where Cu (II)-binding site with His residue changes from Nπ to Nτ to share a Cu(II) ion between two His residues in the different peptide chains (Fig. 6(B)). The coordination mode of Cu-1N3O (one Cu atom coordinates one nitrogen atom and three oxygen atoms) may stem from Cu(II) binding one Nτ of the His residue and three oxygen atoms from the carbonyl of glycine and serine residues or from water (Aronoff-Spencer et al., 2000).

4.3. Influence of K+ of Na+

K+ ion influence on the silk fibroin conformation was investigated by 13C NMR and Raman Spectroscopy (Ruan et al., 2008). Fig. 7(A) shows that, as the added [K+] increases from 0 to 3.7 mg/g, the silk fibroin conformations change partially from helix to β-sheet (Ruan et al., 2008). However, further increase of [K+] from 3.7 to 12.5 mg/g induces a decrease in total Silk II content. In addition, Fig. 7(B) shows that, as [K+] increases from 0 to 3.7 mg/g, the chemical shift of the tyrosyl Cα apical peak moves from the lower field (57.5 ± 0.5 ppm) to the higher field (55.5 ± 0.5 ppm). The change in the tyrosyl Cα chemical shift is thought changing in the environment of the tyrosine within the repetitive crystalline blocks as the fibroin conformation changes from Silk I to Silk II (Asakura et al., 2002; Taddei et al., 2004). It confirms the earlier evidence (Asakura et al., 2002; Taddei et al., 2004) that the environment of the tyrosine residues in the fibroin undergoes a change in hydrophobicity during the formation of β-sheets.

Figure 7.

Effect of [K+] on the silk fibroin conformation. (A) effect of the added [K+] on the total Silk II conformations. (B) solid-state 13C CP/MAS NMR spectra of the tyrosine residues of silk fibroin with added [K+] at (a) 0, (b) 2.5, (c) 3.7 mg/g, and that of silk fiber (d) (From Ruan et al., 2008 with permission).

Figure 8.

Schematic representation of the hypothetical changes in heavy-chain fibroin structure induced by a progressive increase in [K+] (From Ruan et al., 2008 with permission).

The sequence of Bombyx mori heavy-chain silk fibroin has a large number of the palindrome sequences of VGYG (21 repeats)/GYGV (11 repeats), and those special sequences oppose one another at the ends of the extended β-stands (Zhou et al., 2000). At a high K+ ion concentration in the fibroin, these ions may interact with carbonyl oxygen atoms from VGYG/GYGV palindrome sequences.

Combining the NMR and Raman results focused on the tyrosine change (Ruan et al., 2008), we propose a process of molecular chain movement shown in Fig. 8 as [K+] is increased. In region I of Fig. 8, as the added [K+] increases from 0 to 1.2 mg/g, the tyrosine changes from a hydrophobic environment to the environment in which there is moderate hydrogen bonding. We suggest that, when the regenerated silk fibroin is in the helix (Silk I) and/or random coil conformation, the tyrosyl groups exist in a highly hydrophobic environment. The packing of the helix structure with an intra-chain H-bond is unfavorable for the phenolic-OH hydrogen-bonding interactions (Taddi et al., 2004). An increase in [K+] may induce movement of the main chains, causing tyrosine to leave its hydrophobic environment and be exposed on the surface of protein when the fibroin is in the helix-like conformation. This change in the tyrosine environment may allow the phenolic-OH oxygen to act as an acceptor of a hydrogen atom as the serine hydroxyl group to do in the silk fibroin main chain (Taddei et al., 2004) with weakly hydrogen-bonding strength, causing the silk fibroin to undergo a secondary structural transition to the Silk II conformation. As the added [K+] increases from 1.2 to 3.7 mg/g (region II), the phenolic-OH acts progressively as an acceptor of strong hydrogen bonding, giving rise to the β-sheet-related conformation. At a [K+] of 3.7 mg/g, the hydrogen bonding between tyrosine phenolic-OH oxygen and the main chain hydrogen donor in the β-sheet conformation is strongest at the point at which the total Silk II content reaches its maximum. However, a further increase in the [K+] up to 6.2 mg/g may result in some decrease in β-sheet-like conformation and the disordered intermediate re-appears. As added [K+] increases from 6.2 to 12.5 mg/g (region III), the silk fibroin conformation is thought to return to the helix and/or random coil state. This may result from the tendency of the ions to prevent β-sheet hydrogen bond formation at high fibroin concentrations as a consequence of its chaotropic effect. In region III, the tyrosine residues have returned to a hydrophobic environment.

Figure 9.

Dependence of total Silk II contents upon [Na+] (From Ruan & Zhou, 2008 with permission).

Moreover, we investigated Na+ ion effect on the silk fibroin conformation (Ruan et al., 2008). Samples are Na+-contained regenerated silk fibroin films. 13C CP/MAS NMR demonstrates that as the added [Na+] increases, partial silk fibroin conformation transit from helix-form to β-form at certain Na+ ion concentration which is much higher than that in B. mori silkworm gland. Fig. 9 shows the dependence of total Silk II content upon [Na+]. As [Na+] increase from 0 to 11.2 mg/g, there is no significant change in the Silk II content, and as [Na+] increase up to 37.5 mg/g, the Silk II content increases from original 24% to the highest of 31%. As [Na+] further increase to 56.2 mg/g, the Silk II content slightly drops down from 31% to 29%. The influence of Na+ ion on the silk fibroin conformation is not so evident as that of Ca2+, Cu2+ and K+ ions.

4.4. Influence of ferric and ferrous ions

Fe3+/SF and Fe2+/SF samples were studied with 13C CP/MAS NMR spectroscopy to compare the different effects of ferric and ferrous ions on the conformation of silk fibroin. The effect of ferric and ferrous ions on the Silk II contents is shown in Fig. 10 (Ji et al., 2009). Within the range 0 - 75.0 μg/g of iron ions contents, Silk II contents for Fe3+/SF and Fe2+/SF are closely comparable: slowly decreasing but lying between 17% and 22%. However, when iron ions exceed 75 μg/g, Silk II content of Fe3+/SF samples increased progressively and markedly up to about 40% at 125 μg/g of [iron] (Fig. 10-a), but that of Fe2+/SF samples only increased slightly (Fig. 10-b). It indicated that a small amount of ferric ions could maintain the ratio of [helix-form]/[β-sheet form] as constant in the silk fibroin. But if more ferric ions were added, more β-sheet structures would be formed due to the interaction of ferric ions with the specific residues in fairly conserved hydrophilic spacers in the heavy chain fibroin sequence. Once the folding template was formed, the folding process would be markedly accelerated (Gillmor et al., 1997) because of the strong hydrophobic interactions between the hydrophobic spacers in the silk fibroin, leading to the aggregation of β-sheet components. The process was demonstrated nucleation dependent (Li et al., 2001).

Figure 10.

Dependence of Silk II contents (including -sheet and -sheet-like components) on the added [Fe3+] or [Fe2+] in silk fibroin: (a) Fe3+/SF samples, (b) Fe2+/SF samples. The simulation error is ± 2% (From Ji et al., 2009).

Figure 11.

The experimental (a) and simulated (b) EPR spectra of Fe3+/SF sample with the added [Fe3+] of 75.0 μg/g under the magnetic field strength of 9.45 GHz, T = 100 K. The simulated parameters are as follows: g1 = 1.950, g2 = 1.990, g3 = 1.995, D = 2 cm-1 and E/D = 1/3 and the line width peak to peak is 4 MHz (From Ji et al., 2009 with permission).

Fe3+/SF samples with [Fe3+] of 75.0 and 125.0 μg/g were measured by EPR spectrometer. Fe3+/SF sample with [Fe3+] of 75.0 μg/g has the lowest Silk II content while that with [Fe3+] of 125.0 μg/g has the highest Silk II content (see Fig. 10), but they have a similar EPR spectrum as shown in Fig. 11-a with [Fe3+] of 75.0 μg/g. Only one signal at ~ 4.25 was observed, which implied that the transition occurred at energy level 3 → 4 (Bou-Abdallah & Chasteen, 2008). The EPR signal of pure FeCl3 sample was not observed in the samples. Fig. 11-b is the simulated spectrum. The parameters extracted from the simulation are as follows: the zero-field-splitting interaction D = 1.2 ~ 2 cm-1 which is larger than the applied magnetic field B of 0.315 cm-1 (i.e. X-band) in our experiment; E/D = 1/3; the theoretic g-value = 1.950, 1.990, and 1.995. Based on the apparent g-value, = 4.25, and those simulated parameters, we could conclude that the ferric ions in the silk fibroin are at high-spin state of S = 5/2 and low symmetric site (Teschner et al., 2004).

Bou-Abdallah and Chasteen (Bou-Abdallah & Chasteen, 2008) assigned the EPR signal of = 4.25 with zero-field-splitting interaction of |D| ≤ 2 cm-1 and E/D = 1/3, to a mononuclear high-spin ferric ions (S = 5/2) in a site of low symmetry, which is often observed in many proteins (Aasa et al., 1963; Solomon et al., 2000; Taboy et al., 2001). Tyrosine, histidine, glutamine and aspartate generally have a strong ability to coordinate with ferric ions. All of those residues are located in the spacer regions of the proteins. Interestingly, the 11 highly conserved hydrophilic spacers TGSSGFGPYVAN(H)GGYSGYEYAWSSESDFGT in the heavy chain of silk fibroin also play a role as a linker and include all of the residues which are considered as potential binding sites for the ferric ions. The spacer in silk fibroin connects two regularly arranged sequences, i.e. (GAGAGS)n and/or (GA(V)GAGY)n in helix-form (Silk I) or β-sheet form (Silk II). As a result, silk fibroin might bind to ferric ions with those residues in the hydrophilic spacers. If ferric ions were trapped in such regions, the β-sheet folding center might be formed, and thereafter the folding process could be accelerated if more ferric ions were added.

4.5. Influence of Mn2+

Figure 12 shows the EPR spectra of Mn(II)/SF samples which were prepared from samples with an initial pH’s of 7.5, 6.0 and 5.2 (Deng et al., 2011). All three spectra shown in Figure 12-c’s with the added Mn(II) contents of 40.0 μg/g were almost identical, indicating that the environments of the Mn(II) ions were not pH dependent. Fig. 12-d’s show typical sextet splitting along with double peaks between the adjacent peaks, very similar to that of MnCl2 in 12 M HCl aqueous solution and in methyl alcohol solution at frozen state (T = 90 K) (Allen & Nebert, 1964), where Mn2+ ion is in the Mn(H2O)62+ complex. However, Figure 12-a’s and 12-b’s with Mn(II) contents of 4.0 and 10.0 μg/g, respectively, show somewhat pH dependency; the sextet splitting becomes evident as pH decrease from 7.5 to 5.2.

Figure 12.

Dependence of EPR spectra of [Mn(II)]/SF samples with different added contents of Mn(II) upon pH. (a), (b), (c) represent the added [Mn(II)] of 4.0, 10.0, 40.0 μg/g under pH of 7.5 (A), 6.0 (B), 5.2 (C), respectively. The peaks marked with arrows are free radical signals, respectively. The six stick-lines on the top of figure indicate the sextet splitting of Mn(II) with A = 96 G. All the spectra were recorded at 100 K, υ = 9.45 GHz, sweep width = 1500 G (From Deng et al., 2011 with permission).

Figure 13.

Dependence of total Silk II (summary of Silk II and Silk II-like) conformations on the added [Mn(II)] at pH of 7.5 (a), 6.0 (b), and 5.2 (c) (From Deng et al., 2011 with permission).

13C CP/MAS NMR of silk fibroin was studied to investigate the effect of Mn(II) ions on the conformational transition of silk fibroin. Fig. 13 (Deng et al., 2011) shows the dependence of total Silk II contents (including Silk II and Silk II-like conformations) upon the added Mn(II) content and pH. Mn(II) ions over the concentration range studied show no detectable effect on the Silk II content except for a very small but significant increase by 5% in Silk II conformation at Mn(II) content of 4.0 g/g and pH from 5.2 to 7.5. The total Silk II maximum content of 32 2% was observed at the added [Mn(II)] of 4.0 μg/g and at pH of 7.5, while the content is much lower compared with the content of 54 2% obtained by adding cupric ions to the regenerated SF (Zong et al., 2004). Besides, the EDTA-treated silk fibroin had almost the same NMR spectrum as pure silk fibroin (data not shown). These observations indicate that Mn(II) had no detectable effect on the promotion of the conformation transition in SF. Those results indicate that there are two types of Mn(II) complexes present in the silk fibroin: one is six-coordinated Mn(II)/SF complex when the content of Mn(II) is small (less than 10.0 μg/g), and the other is Mn(H2O)62+ complex which predominates at higher Mn(II) concentrations. The six-coordinated complex may be formed with the Asp, Glu and His residues in the hydrophilic spacers, promoting the Silk II conformation. In contrast, the Mn(H2O)62+ complex might stabilize the first water shell thereby tending to maintain the silk fibroin Silk I conformation, therefore leading to the pH almost hardly influencing the conformation transition of the silk fibroin. Mn(II) ions, existing in the silk gland (Zhou et al., 2005), may play a role in maintaining the appropriate balance of the secondary structure components including helix-form and -form to keep the silk fibroin stable in liquid state in the secretory pathway.

Dependence of the silk fibroin secondary structure transition upon different added metal ions is summarized in Table 3. From Table 3, Ca2+, Cu2+, K+, Fe3+ ions show the evident effect on the conformation transition of the silk fibroin, while Na+, Fe2+ and Mn2+ ions show a weak effect.

Metal IonsSilk I to Silk II transitionreferences
Ca2+yesZhou et al., 2004
Cu2+Zong et al., 2004
K+Ruan et al., 2008
Fe3+Ji et al., 2009
Na+noRuan et al., 2008
Fe2+Ji et al., 2009
Mn2+Deng et al., 2011

Table 3.

Dependences of the silk fibroin secondary structure transition upon different added metal ion.

5. Conclusion

The function of protein is closely dependent on the structure of protein. The components and the secondary structures of the silk fibroin evidently affect the mechanical properties of the structural protein. Magnetic resonance methods (NMR and EPR) demonstrate that the conformation of the silk fibroin can be changed from random coil and/or helix to β-sheet under certain pH value and metal ion concentration along with the change in the coordination of silk fibroin with the metal ions as well as the change in the hydrophilic and hydrophobic environments of the protein. The results are helpful for understanding the mechanism of silkworm spinning and will give the guidance for fabricating the artificially high performance biomaterials.


The projects were supported by National Natural Science Foundation of China (Nos. 10475017, 20434010, 20673022 and 29974004). We also thank many dedicated coworkers who have contributed to the researches.

How to cite and reference

Link to this chapter Copy to clipboard

Cite this chapter Copy to clipboard

Teng Jiang and Ping Zhou (August 29th 2011). Environment-Induced Silk Fibroin Conformation Based on the Magnetic Resonance Spectroscopy, On Biomimetics, Assoc. Lilyana D. Pramatarova, IntechOpen, DOI: 10.5772/18479. Available from:

chapter statistics

2304total chapter downloads

1Crossref citations

More statistics for editors and authors

Login to your personal dashboard for more detailed statistics on your publications.

Access personal reporting

Related Content

This Book

Next chapter

Biomimetic Approaches to Understanding the Mechanism of Haemozoin Formation

By Timothy J. Egan

Related Book

First chapter

Biomimetic Synthesis of Nanoparticles: Science, Technology & Applicability

By Prathna T.C., Lazar Mathew, N. Chandrasekaran, Ashok M. Raichur and Amitava Mukherjee

We are IntechOpen, the world's leading publisher of Open Access books. Built by scientists, for scientists. Our readership spans scientists, professors, researchers, librarians, and students, as well as business professionals. We share our knowledge and peer-reveiwed research papers with libraries, scientific and engineering societies, and also work with corporate R&D departments and government entities.

More About Us